PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011095575.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YB
Protein Properties Length: 233aa    MW: 25804.2 Da    PI: 9.2559
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011095575.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB154.81.5e-4850144296
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     r+ d+++Pianv+rim+++lPa+aki++daket+qecvsefi+f+tsea+dkc+re rkti++dd+l a++tlGf++y+epl+ yl++yr  + e
  XP_011095575.1  50 RDPDQYMPIANVIRIMRRILPAHAKIADDAKETIQECVSEFIGFITSEANDKCHREYRKTITPDDVLSAMGTLGFDNYIEPLTFYLNRYRAQDPE 144
                     688***************************************************************************************87655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.6E-4545148IPR009072Histone-fold
SuperFamilySSF471134.84E-3553147IPR009072Histone-fold
PfamPF008081.3E-2355119IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-1583101No hitNo description
PRINTSPR006151.2E-15102120No hitNo description
PRINTSPR006151.2E-15121139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MESGGSSNPK HKSNTKRTPQ SGIVIREPSA APANIPNNAA GLNPEQTFKR DPDQYMPIAN  60
VIRIMRRILP AHAKIADDAK ETIQECVSEF IGFITSEAND KCHREYRKTI TPDDVLSAMG  120
TLGFDNYIEP LTFYLNRYRA QDPERASMHQ LPFIRRAAGP VQPRPAAQMP VARPPPLQVP  180
PQTAMRFAPP ARFAVEGGNY AALPQIGDYF VGNEGGGEGS SGGYLYDRYR QFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3750139392NF-YB
4awl_B2e-3750139493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-3750139493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095575.11e-172PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W663e-51NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A022RAV02e-62A0A022RAV0_ERYGU; Uncharacterized protein (Fragment)
STRINGVIT_00s0956g00020.t018e-50(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.25e-50nuclear factor Y, subunit B6